Mechanism
Tirzepatide is a dual agonist at the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors. Both are incretin hormones released by intestinal cells in response to a meal. Activating both at once is novel — endogenous GIP and GLP-1 work in parallel, but no native peptide hits both receptors simultaneously.
The molecular design is similar to semaglutide’s: a fatty-acid side chain that allows albumin binding and resists enzymatic degradation, giving a half-life of approximately 5 days and supporting once-weekly subcutaneous dosing.
The dual agonism appears to do more than simply add the effects of two single-agonist drugs. The GIP receptor activation contributes to body-fat reduction, lipid metabolism improvements, and possibly to the better tolerability of higher doses than would be expected from GLP-1 alone. The mechanism is not fully understood — the field is still working out why the dual agonist outperforms the GLP-1 single-agonist comparator in head-to-head trials.
What the evidence shows
Selected pivotal trials:
- SURPASS-1 through SURPASS-5 (2021–2022): Multi-site RCTs in type 2 diabetes versus placebo, semaglutide, and insulin comparators. Showed ~2.0–2.5% HbA1c reduction at higher doses; superior to semaglutide 1mg in head-to-head SURPASS-2.
- SURMOUNT-1 (2022): Obesity trial in adults with BMI ≥30 (or ≥27 with comorbidity). 15mg dose produced ~21% mean weight loss versus 3% with placebo over 72 weeks.
- SURMOUNT-2 (2023): Obesity trial in patients with T2D. ~15% mean weight loss at 15mg.
- SURMOUNT-3 / SURMOUNT-4 (2023–2024): Lifestyle-intervention add-on and maintenance-of-weight-loss trials, both showing sustained effect.
- SURPASS-CVOT (reading out 2025): Cardiovascular outcomes trial; data not fully published as of this review.
- SUMMIT (2024): Tirzepatide in patients with obesity and HFpEF; significant improvements in heart failure symptoms.
The evidence base is younger than semaglutide’s — the drug was approved in 2022 — but the trial programs were designed to be confirmatory from the start, with active comparators and meaningful sample sizes. The effect sizes are large enough that the verdict doesn’t depend on subtle statistics.
Dosing literature
Approved dosing (subcutaneous, once weekly):
- Type 2 diabetes (Mounjaro): 2.5mg → 5mg → 7.5mg → 10mg → 12.5mg → 15mg, with 4-week steps for tolerability
- Obesity (Zepbound): Same titration ladder; target dose individualized based on response and tolerability
The titration is more granular than semaglutide’s because the GI burden ramps up faster with tirzepatide. Skipping titration steps is the most common cause of intolerable nausea and discontinuation.
There is no oral formulation. Tirzepatide is subcutaneous injection only.
Risks and adverse events
Common: Nausea (~25%), vomiting (~10%), diarrhea, constipation, decreased appetite, dyspepsia, abdominal pain. The GI profile is similar to semaglutide but slightly more frequent at therapeutic doses.
Less common but important:
- Acute pancreatitis — case reports; signal is monitored but not strongly established
- Gallbladder disease — increased rate, particularly with rapid weight loss
- Acute kidney injury — reported in patients with severe vomiting/dehydration
- Diabetic retinopathy worsening — observed in some patients with rapid HbA1c improvement (consistent with the GLP-1 class effect)
- Hypoglycemia — uncommon as monotherapy; can occur when combined with insulin or sulfonylureas
Pre-clinical / theoretical: Medullary thyroid C-cell tumors in rodents (class effect with all GLP-1 receptor agonists); contraindicated with personal or family history of MTC or MEN2.
Self-sourced tirzepatide adds risks not present with the FDA-approved product: counterfeit or misdosed compounds, contamination, dosing errors. The compounded-tirzepatide market briefly expanded in 2023–2024 during shortage but FDA has restricted it as supply normalized.
Regulatory status
| Region | Diabetes | Obesity | Notes |
|---|---|---|---|
| United States | Approved (Mounjaro) | Approved (Zepbound) | DEA: not scheduled. |
| European Union | Approved | Approved | Same brand names. |
| United Kingdom | Approved | Approved | NHS access criteria apply. |
| Canada | Approved | Approved | |
| Australia | Approved | Approved | |
| Japan | Approved | Approved |
Where to get it
A clinician relationship and an FDA-approved (or equivalent) product through a licensed pharmacy. Same posture as semaglutide: self-sourcing is a category of decision we do not endorse.
We have no fulfillment partner for tirzepatide at this time. (See How we make money — the absence of a partner link is a deliberate signal.)
References (selected)
- Frías JP et al. Tirzepatide versus Semaglutide Once Weekly in Patients with Type 2 Diabetes. N Engl J Med 2021 (SURPASS-2). PubMed
- Jastreboff AM et al. Tirzepatide Once Weekly for the Treatment of Obesity. N Engl J Med 2022 (SURMOUNT-1). PubMed
- Garvey WT et al. Tirzepatide once weekly for the treatment of obesity in people with type 2 diabetes. Nat Med 2023 (SURMOUNT-2).
- Packer M et al. Tirzepatide for Heart Failure with Preserved Ejection Fraction and Obesity. N Engl J Med 2024 (SUMMIT).
- FDA prescribing information, Mounjaro and Zepbound — current revisions.
Quick Facts
| Also Known As | LY3298176, GIP/GLP-1 receptor co-agonist |
|---|---|
| Sequence | H-YXEGTFTSDYSIYLDKQAAKEFVQWLLAGGPSSGAPPPS-NH2 (where X = Aib, α-aminoisobutyric acid) |
| Molecular Formula | C225H348N48O68 |
| Molecular Weight | 4813 Da |
| PubChem CID | 166567236 |
Research Parameters
| Half-Life | Approximately 5 days |
|---|---|
| Stability | Lyophilized powder is stable when stored as directed. After reconstitution, stability data suggests it should be used immediately or stored at 2-8°C for a limited period (typically 24-48 hours as per clinical trial protocols), though specific published stability studies for research vials are limited. |
| Solubility | Sterile Water for Injection or Bacteriostatic Water for Injection. In clinical trials, it is supplied in a single-dose prefilled pen. |
| Storage (Lyophilized) | -20°C to -80°C, protect from light and moisture. For long-term storage, desiccate at -20°C or below. |
| Storage (Reconstituted) | 2-8°C (refrigerated) and protected from light. Use within a short timeframe as stability data is limited; do not freeze. |
| Typical Research Dose | 2500-15000 mcg (2.5-15 mg) once weekly in clinical research. Note: Doses are in milligrams for this compound. |
| Cycle Parameters | Once-weekly subcutaneous injection. In clinical research, treatment is typically continuous for the study duration (e.g., 40-72 weeks), often starting with a dose-escalation period over the first 4-12 weeks. |
| Amino Acid Count | 4 |
Mechanism of Action
Tirzepatide functions as a dual agonist at the GIP and GLP-1 receptors, which are class B G protein-coupled receptors (GPCRs) expressed in pancreatic islets, the brain, and other tissues. Its mechanism integrates the complementary actions of both incretin hormones.
GIP Receptor Activation: Tirzepatide binds to and activates the GIP receptor, which in pancreatic beta cells stimulates glucose-dependent insulin secretion via cAMP signaling. In adipose tissue, GIP receptor activation may promote lipid storage and improve insulin sensitivity. Recent evidence also suggests GIP receptor agonism in the central nervous system may contribute to weight loss by modulating appetite, potentially counteracting the compensatory mechanisms that limit sustained weight loss with GLP-1 monotherapy.
GLP-1 Receptor Activation: Concurrently, tirzepatide activates the GLP-1 receptor, enhancing glucose-dependent insulin secretion, suppressing inappropriate glucagon secretion, slowing gastric emptying, and promoting satiety in the brain. This contributes to reduced caloric intake and improved postprandial glucose control.
Integrated Effects: The dual agonism is proposed to produce synergistic or additive effects on glycemic control and body weight. The GIP component may potentiate the insulinotropic effects of the GLP-1 component, especially at higher glucose levels, while also providing distinct metabolic benefits in adipose tissue and the brain that enhance the overall therapeutic profile.
Research Applications
Type 2 Diabetes Mellitus: Clinical trials have demonstrated that tirzepatide significantly reduces hemoglobin A1c (HbA1c) levels, often achieving normoglycemia in a substantial proportion of participants. It improves both fasting and postprandial glucose levels through its combined effects on insulin and glucagon secretion, gastric emptying, and potentially hepatic glucose production.
Obesity and Weight Management: Tirzepatide has shown pronounced dose-dependent reductions in body weight in clinical studies, exceeding those typically seen with selective GLP-1 receptor agonists. This effect is attributed to reduced appetite and energy intake mediated by central actions on satiety centers, alongside slowed gastric emptying.
Cardiometabolic Risk Factors: Research indicates tirzepatide improves several cardiometabolic parameters beyond glycemia and weight. This includes reductions in systolic and diastolic blood pressure, improvements in lipid profiles (e.g., lowering triglycerides), and reductions in liver fat content, suggesting potential benefits for non-alcoholic fatty liver disease (NAFLD) and overall cardiovascular risk.
Beta-cell Function: Preclinical and clinical data suggest that tirzepatide may improve markers of beta-cell function and insulin sensitivity, addressing core pathophysiological defects in type 2 diabetes. The GIP component is hypothesized to be particularly important for beta-cell health and insulin secretion capacity.
Safety & Side Effects
The most common adverse events reported in clinical trials are gastrointestinal in nature, consistent with the mechanism of GLP-1 receptor agonism. These include nausea, diarrhea, vomiting, constipation, decreased appetite, dyspepsia, and abdominal pain. These effects are generally mild to moderate in severity, occur most frequently during dose escalation, and tend to diminish over time. Anecdotally, some individuals report injection site reactions, fatigue, and increased heart rate. Theoretical concerns include the risk of pancreatitis, gallbladder disease, and hypoglycemia when combined with insulin or insulin secretagogues, although clinical trial data have not shown a significant increase in these events compared to comparators. Animal studies have not identified other major safety signals beyond those related to its pharmacologic action.
Dosage Information
This information is derived from published clinical research protocols and is for research purposes only. In clinical trials for type 2 diabetes and obesity, tirzepatide is administered via subcutaneous injection. The dose is typically initiated low and escalated over several weeks to improve gastrointestinal tolerability. Common research dosing regimens involve once-weekly administration at doses of 5 mg, 10 mg, or 15 mg. The escalation schedule often starts at 2.5 mg weekly for 4 weeks, then increases to 5 mg. Further increases to 10 mg and 15 mg may occur at 4-week intervals based on tolerability and study protocol. The duration of administration in pivotal trials has ranged from 40 to 72 weeks.
References
Frias, J.P., et al. Efficacy and safety of LY3298176, a novel dual GIP and GLP-1 receptor agonist, in patients with type 2 diabetes: a randomised, placebo-controlled and active comparator-controlled phase 2 trial. Lancet, 2018. 392(10160): p. 2180-2193.
Min, T., & Bain, S. C. The Role of Tirzepatide, Dual GIP and GLP-1 Receptor Agonist, in the Management of Type 2 Diabetes: The SURPASS Clinical Trials. Diabetes Therapy, 2021. 12(1): p. 143-157.
Rosenstock, J., et al. Efficacy and safety of a novel dual GIP and GLP-1 receptor agonist tirzepatide in patients with type 2 diabetes (SURPASS-1): a double-blind, randomised, phase 3 trial. Lancet, 2021. 398(10295): p. 143-155.
Jastreboff, A.M., et al. Tirzepatide Once Weekly for the Treatment of Obesity. New England Journal of Medicine, 2022. 387(3): p. 205-216.
Thomas, M.K., et al. Dual GIP and GLP-1 Receptor Agonist Tirzepatide Improves Beta-cell Function and Insulin Sensitivity in Type 2 Diabetes. The Journal of Clinical Endocrinology & Metabolism, 2021. 106(2): p. 388-396.
Coskun, T., et al. LY3298176, a novel dual GIP and GLP-1 receptor agonist for the treatment of type 2 diabetes mellitus: From discovery to clinical proof of concept. Molecular Metabolism, 2018. 18: p. 3-14.