Survodutide
Verdict card (component)
◐ Promising | for obesity and metabolic dysfunction-associated steatohepatitis (MASH)
A GLP-1 / glucagon dual receptor agonist in late-stage clinical development for obesity and MASH (formerly NASH). Boehringer Ingelheim / Zealand Pharma codeveloping. Phase 2 obesity trial reported ~14.9% mean weight loss at 46 weeks at the 4.8 mg dose — somewhat below tirzepatide’s Phase 3 numbers but mechanistically distinct via the glucagon-receptor arm. Phase 2 MASH data (NEJM 2024, Sanyal et al) showed meaningful histologic improvement in MASH without fibrosis worsening. SYNCHRONIZE Phase 3 program (-1 in obesity without T2D, -2 in obesity with T2D, plus a separate Cardiovascular Outcomes Trial) is reading out from Q1 2026.
Evidence signal row
- ✓ Phase 2 obesity — ~14.9% mean weight loss at 4.8 mg / 46 weeks vs 2.8% placebo
- ✓ Phase 2 MASH (NEJM 2024) — 62% achieved MASH improvement without fibrosis worsening (4.8 mg) vs 14% placebo
- ! Phase 3 reading out Q1 2026 — SYNCHRONIZE-1 and SYNCHRONIZE-2 baseline characteristics published; primary endpoints due imminently
Our verdict (3 sentences)
Survodutide is one of three GLP-1/glucagon dual agonists in late-stage development (with mazdutide and cotadutide); the dual-agonism approach is a real second-wave attempt to extend obesity therapy beyond GLP-1-only and dual GIP/GLP-1 (tirzepatide). The Phase 2 data is impressive but Phase 3 confirmation is what makes the verdict definitive — Phase 2 obesity drugs frequently see effect-size attenuation in Phase 3 with broader populations and longer follow-up. The MASH pathway is what makes survodutide particularly interesting strategically: the glucagon arm of the dual-agonism is mechanistically suited to hepatic fat mobilization, and MASH is a large, mostly-unaddressed indication where dual agonists may be the better fit than GLP-1 alone.
Mechanism
Survodutide is a long-acting peptide co-agonist at the GLP-1 receptor and the glucagon receptor. Daily/weekly subcutaneous injection (formulation supports once-weekly dosing).
The dual-agonism rationale parallels retatrutide (which adds GIP) but with a different second receptor:
- GLP-1 agonism: appetite suppression, slowed gastric emptying, glucose-dependent insulin secretion (familiar from semaglutide/liraglutide)
- Glucagon agonism: increased energy expenditure, hepatic fat oxidation, increased basal metabolic rate
Glucagon agonism alone would seem counterproductive in a metabolic drug (glucagon raises blood glucose). But the GLP-1 component provides robust glucose-lowering, and the glucagon arm contributes additional fat-mass reduction and hepatic effects that GLP-1 alone doesn’t fully achieve.
The hepatic effects are the strategically interesting part. Glucagon activation in hepatocytes increases fatty-acid oxidation and reduces hepatic steatosis — the mechanism behind the MASH efficacy signal. This is biologically distinct from how GLP-1-only drugs work (which improve MASH largely through weight loss and insulin sensitization, with weaker direct hepatic effects).
What the evidence shows
Phase 2 obesity (le Roux et al, Lancet Diabetes Endocrinol 2024): Adults with obesity, BMI ≥27, no T2D. Random assignment to multiple survodutide doses or placebo for 46 weeks.
Results at 46 weeks (mean body weight reduction):
– Placebo: 2.8%
– Survodutide 4.8 mg: 14.9%
(Lower-dose arms produced intermediate results between placebo and the 4.8 mg arm.)
Phase 2 MASH (Sanyal et al, NEJM 2024): Adults with biopsy-confirmed MASH and stage F1–F3 fibrosis, randomized to survodutide 2.4 mg / 4.8 mg / 6.0 mg or placebo for 48 weeks. Primary endpoint: improvement in MASH without worsening of fibrosis.
Results at 48 weeks:
| Endpoint | 2.4 mg | 4.8 mg | 6.0 mg | Placebo |
|---|---|---|---|---|
| MASH improvement, no fibrosis worsening | 47% | 62% | 43% | 14% |
| ≥30% relative reduction in liver fat (MRI-PDFF) | 63% | 67% | 57% | 14% |
| Improvement in fibrosis by ≥1 stage | 34% | 36% | 34% | 22% |
Note that the 4.8 mg dose was the most effective on the primary endpoint; the 6.0 mg dose did not produce additional benefit and had higher GI adverse-event burden — a not-uncommon pattern in dose-finding for this class.
The MASH histologic data is particularly important. Hepatic fat reduction by imaging is a soft endpoint; biopsy-confirmed histologic improvement is what regulators require for MASH approval. Survodutide’s Phase 2 hit both.
Phase 3 SYNCHRONIZE program:
- SYNCHRONIZE-1 — obesity without T2D, ~726 randomized at 133 sites across 19 countries. Primary endpoint: percent body weight change and ≥5% weight reduction at Week 76. Last visit Q1 2026; baseline characteristics published 2026 (le Roux et al, Diabetes Obes Metab 2026).
- SYNCHRONIZE-2 — obesity with T2D, ~752 treated participants. Baseline characteristics published 2026 (Wharton et al, Diabetes Obes Metab 2026).
- SYNCHRONIZE Cardiovascular Outcomes Trial — separately designed, baseline characteristics published 2025 (JACC: Heart Failure); reads out later than the primary obesity trials.
Why we hold at Promising: Phase 2 obesity data is solid, Phase 2 MASH data is strong (the 4.8 mg arm hitting 62% MASH-improvement-without-fibrosis-worsening is approval-relevant for the MASH indication). Phase 3 obesity is reading out imminently — the verdict will likely move to Established by next review if SYNCHRONIZE-1/-2 confirm Phase 2 effect sizes.
Dosing literature
There is no approved dose because the drug is not approved. Phase 2/3 protocols have used:
- Weekly subcutaneous, with dose titration over multiple weeks
- Phase 2 maximum: 4.8 mg/week
- Phase 3 protocols are evaluating doses up to 6 mg/week in some arms
Like other dual agonists, GI tolerability scales with dose; titration over 4–8 weeks is standard.
Risks and adverse events
Common (Phase 2 data):
- Nausea (~50% at higher doses), vomiting, diarrhea — typical for the GLP-1-class component
- Decreased appetite (the desired effect; modest grade only)
- Constipation, dyspepsia
- Injection site reactions
Glucagon-specific concerns:
- Heart rate increases (modest, dose-dependent) — observed in Phase 2 and being characterized in Phase 3
- Theoretically possible glycemic destabilization in T2D patients on insulin
- Lipid effects under study
Less common:
- Cholelithiasis (class effect with rapid weight loss)
- MTC C-cell tumor warning (class effect; no human signal but the rodent data triggers the warning across all GLP-1 family drugs)
**No
Quick Facts
| Also Known As | BI 456906 |
|---|---|
| Sequence | His-Ser-Gln-Gly-Thr-Phe-Thr-Ser-Asp-Tyr-Ser-Lys-Tyr-Leu-Asp-Ser-Arg-Arg-Ala-Gln-Asp-Phe-Val-Gln-Trp-Leu-Met-Asn-Thr-Lys-Arg-Asn-Arg-Asn-Asn-Ile-Ala (Single-letter: HSQGTFTSDYSKYLDSRRAQDFVQWLMNTKRNRNNIA) |
| Molecular Formula | C192H289N47O61 |
| Molecular Weight | 4232 Da |
| PubChem CID | 171378821 |
Research Parameters
| Half-Life | Approximately 110-130 hours (based on clinical trial pharmacokinetic data supporting once-weekly dosing) |
|---|---|
| Stability | Specific stability data for the research-grade lyophilized powder are not publicly disclosed. For clinical trial materials, it is stored under controlled conditions. After reconstitution for clinical use, it is typically used immediately or stored refrigerated for a limited period as per protocol. |
| Solubility | In clinical trials, it is supplied in a solution for injection. For hypothetical research use of lyophilized material, bacteriostatic water or sterile phosphate-buffered saline would be standard reconstitution solvents. |
| Storage (Lyophilized) | Unspecified for research chemical form. Clinical trial material is stored at 2-8°C. For analogous peptides, recommended storage is -20°C or below, protected from light. |
| Storage (Reconstituted) | For clinical trial solution: 2-8°C. Use within a specified period (e.g., 28 days) after first use. Not applicable for single-use vials. |
| Typical Research Dose | In clinical research, doses are expressed in mg (e.g., 0.3 mg to 6.0 mg, which equals 300 mcg to 6000 mcg). |
| Cycle Parameters | In clinical research protocols, it is administered as a continuous, once-weekly subcutaneous injection, often following a dose-escalation phase over several weeks. Study durations have typically been 16 to 46 weeks of continuous treatment. |
| Amino Acid Count | 38 |
Mechanism of Action
Survodutide exerts its effects through balanced agonism at two class B G-protein-coupled receptors (GPCRs), the GLP-1 receptor and the glucagon receptor. This dual activity triggers a synergistic cascade of intracellular signaling pathways primarily involving Gαs-mediated adenylate cyclase activation and subsequent cyclic AMP (cAMP) production. The integrated signaling from both receptors underlies its multifaceted metabolic actions.
GLP-1 Receptor Pathway: Activation of pancreatic beta-cell GLP-1Rs enhances glucose-dependent insulin secretion, suppresses inappropriate glucagon release, and slows gastric emptying. In the central nervous system, particularly in hypothalamic nuclei, GLP-1R activation promotes satiety and reduces food intake via neural circuits involved in appetite regulation.
Glucagon Receptor Pathway: Activation of hepatic GCGR stimulates gluconeogenesis and glycogenolysis, but its chronic agonism in the context of dual agonism primarily drives beneficial metabolic effects. These include increased hepatic fatty acid oxidation, energy expenditure (thermogenesis), and reduction of hepatic steatosis (fatty liver). The glucagon component also contributes to appetite suppression through central mechanisms distinct from, but complementary to, GLP-1.
Research Applications
Obesity and Weight Management: Clinical trials have demonstrated that survodutide induces significant, dose-dependent reductions in body weight. The dual mechanism appears to produce greater weight loss than GLP-1 mono-agonists, attributed to combined suppression of appetite (via GLP-1R and GCGR in the brain) and increased energy expenditure (primarily via hepatic GCGR activation).
Non-alcoholic Steatohepatitis (NASH) and Metabolic Dysfunction-Associated Steatotic Liver Disease (MASLD): Preclinical and clinical data indicate that survodutide reduces liver fat content and improves markers of liver injury. The glucagon receptor agonism is believed to directly enhance hepatic lipid metabolism and reduce inflammation and fibrosis, addressing key pathological features of NASH beyond weight loss alone.
Type 2 Diabetes Mellitus: By enhancing glucose-dependent insulin secretion and improving insulin sensitivity (partly through weight loss and hepatic effects), survodutide improves glycemic control. Its mechanism may offer advantages in patients with obesity-driven diabetes by targeting multiple facets of the disease pathophysiology.
Safety & Side Effects
The safety profile from clinical trials is consistent with the mechanism of action of GLP-1/glucagon receptor agonism. The most commonly reported adverse events are gastrointestinal, including nausea, vomiting, diarrhea, and constipation, which are typically mild to moderate in severity and often transient, especially with dose titration. These effects are attributed primarily to GLP-1 receptor activation. No unexpected safety signals unique to dual agonism have been widely reported in completed trials. Theoretical concerns based on glucagon's pharmacology include potential for transient increases in blood glucose and heart rate, though these have not been major clinical issues in trials to date. Long-term safety data beyond one year are not yet available.
Dosage Information
This information is derived from published clinical research protocols only and is not intended for direct human use outside of controlled clinical trials. In Phase 2 clinical trials for obesity, survodutide has been administered via subcutaneous injection. The dosing typically involves a dose-escalation regimen to improve gastrointestinal tolerability, starting at lower doses (e.g., 0.3 mg or 0.7 mg) and titrating up over several weeks to maintenance doses ranging from 1.4 mg to 6.0 mg. The injection frequency in studies has been once weekly. Treatment duration in completed trials has ranged from 16 to 46 weeks.
References
Le Roux, C. W., et al. 'Dual GLP-1/glucagon receptor agonist BI 456906: A phase I multiple ascending dose study in overweight or obese people without diabetes.' Diabetes, Obesity and Metabolism, vol. 25, 2023.
Tillner, J., et al. 'A novel dual glucagon-like peptide and glucagon receptor agonist BI 456906: Tolerability, pharmacokinetics, and pharmacodynamics in single and multiple ascending dose trials.' Diabetes, Obesity and Metabolism, vol. 25, 2023.
Lundgren, J. R., et al. 'Healthy weight loss maintenance with exercise, GLP-1 receptor agonist, or both combined.' New England Journal of Medicine, vol. 385, 2021. (Contextual reference for GLP-1 mechanisms)
Müller, T. D., et al. 'Glucagon-like peptide 1 (GLP-1).' Molecular Metabolism, vol. 30, 2019.
Finan, B., et al. 'A rationally designed monomeric peptide triagonist corrects obesity and diabetes in rodents.' Nature Medicine, vol. 21, 2015. (Seminal paper on unimolecular multi-agonists)
Ambery, P., et al. 'MEDI0382, a GLP-1 and glucagon receptor dual agonist, in obese or overweight patients with type 2 diabetes: a randomised, controlled, double-blind, ascending dose and phase 2a study.' The Lancet, vol. 391, 2018. (Reference for dual agonist class)