Mechanism
Retatrutide is a triple agonist at the GLP-1, GIP, and glucagon receptors. The first two are familiar from semaglutide and tirzepatide; the third — glucagon receptor agonism — is the genuinely new lever.
Glucagon agonism alone would seem counterproductive in a metabolic drug: glucagon raises blood glucose. But glucagon receptor activation also increases energy expenditure, hepatic fat oxidation, and basal metabolic rate. Combining it with the appetite-suppression and insulin-sensitizing effects of GLP-1 and GIP appears to flip the balance: net weight loss is greater, with the glucagon arm contributing fat-mass reduction and improved metabolic flexibility.
The peptide is engineered with a fatty-acid side chain in the same family as semaglutide and tirzepatide, supporting once-weekly subcutaneous dosing (estimated half-life ~6 days).
What the evidence shows
Phase 2 — Jastreboff AM et al, NEJM 2023:
A 48-week trial in adults with obesity (BMI ≥30, or ≥27 with comorbidity), no diabetes, comparing 1mg, 4mg, 8mg, and 12mg weekly to placebo. Mean weight loss at 48 weeks:
- Placebo: 2.1%
- 1mg: 8.7%
- 4mg: 17.1%
- 8mg: 22.8%
- 12mg: 24.2%
These are the largest weight-loss numbers seen in any pre-approval obesity trial to date.
Phase 2 in T2D (Rosenstock J et al, Lancet 2023):
Smaller study (281 patients) showing HbA1c reductions of 1.6–2.0% at higher doses, weight loss ~17% at 12mg over 36 weeks. Glycemic effects are competitive with tirzepatide’s.
Phase 3 — TRIUMPH program:
Multiple ongoing Phase 3 trials covering obesity (TRIUMPH-1, -2, -3), obesity in T2D (TRIUMPH-4), and cardiovascular outcomes (TRIUMPH-OUTCOMES). Most are recruiting or running through 2026–2027. Until these read out, the verdict cannot be elevated to Established.
The Phase 2 data is unusually strong, but Phase 3 obesity trials sometimes attenuate Phase 2 effect sizes by 10–30% as the patient population becomes more representative. We expect retatrutide to remain the leading-edge therapy even with that haircut.
Dosing literature
There is no approved dose because the drug is not yet approved. Trial protocols have used:
- Loading: 1mg or 2mg weekly subcutaneous, with 4-week dose-escalation steps
- Target: 4mg, 8mg, or 12mg weekly depending on tolerability and effect
Like tirzepatide, the titration is granular because GI tolerability scales with dose.
Risks and adverse events
Common (Phase 2 data): Nausea (~30% at higher doses), diarrhea, constipation, vomiting, decreased appetite. Profile similar to other GLP-1-class drugs but somewhat more frequent at the highest doses.
Glucagon-specific concerns:
- Theoretically, glucagon agonism could worsen glycemic control in some patients. In trials so far, the GLP-1/GIP components dominate and net glycemic effects are favorable, but this could differ in patients with brittle diabetes.
- Heart-rate increases were observed in trials (modest, consistent across doses); long-term cardiovascular implications unclear.
Less common but reported:
- Modest dose-dependent increases in heart rate
- Theoretical increases in lipolysis and free fatty acids — implications for hepatic steatosis are unclear
Pre-clinical / theoretical: Same MTC class warning as other GLP-1 agonists; contraindicated with personal/family history of medullary thyroid carcinoma.
The drug is not yet approved. All access is through clinical trial enrollment. Self-sourced “retatrutide” sold via gray-market peptide vendors is a high-risk product — no manufacturing oversight, no certainty about identity or purity, no clinical monitoring.
Regulatory status
| Region | Status | Notes |
|---|---|---|
| United States | Not approved (Phase 3) | Eli Lilly is the developer (LY3437943). |
| European Union | Not approved (Phase 3) | |
| United Kingdom | Not approved (Phase 3) | |
| All others | Not approved |
Expected first regulatory submission late 2026 / early 2027 if TRIUMPH-1 reads out positively.
Where to get it
The only legitimate access path is enrolling in an active clinical trial. Trial sites are listed on ClinicalTrials.gov under the TRIUMPH program identifiers.
We do not route readers to any fulfillment partner for retatrutide. The unapproved regulatory status combined with the gray-market quality variance puts this firmly outside what we’ll endorse. (See How we make money.)
References (selected)
- Jastreboff AM et al. Triple-Hormone-Receptor Agonist Retatrutide for Obesity — A Phase 2 Trial. N Engl J Med 2023. PubMed
- Rosenstock J et al. Retatrutide, a GIP, GLP-1, and glucagon receptor agonist, for type 2 diabetes: a phase 2 randomized trial. Lancet 2023.
- ClinicalTrials.gov — TRIUMPH program (NCT05882045 and related).
- Eli Lilly investor disclosures — Phase 3 timelines.
Quick Facts
| Also Known As | LY3437943, GIP/GLP-1/GCGR triple agonist |
|---|---|
| Sequence | Single-letter: YXEGTFTSDYSIYLDKQAAKEFVQWLLAGGPSSGAPPPS-NH2 (where X = Aib, 2-aminoisobutyric acid). The sequence is a modified exendin-4 backbone with specific amino acid substitutions to confer triple receptor agonism. |
| Molecular Formula | C221H342N46O68 |
| Molecular Weight | 4731 Da |
| PubChem CID | 171390338 |
Research Parameters
| Half-Life | Approximately 50-60 hours in humans, supporting once-weekly subcutaneous administration. |
|---|---|
| Stability | Lyophilized powder is stable when stored as directed. After reconstitution with appropriate solvent, the solution should be used promptly or stored refrigerated for a limited time as per specific study protocol; exact stability data for reconstituted product is proprietary. |
| Solubility | In clinical trials, reconstituted with provided diluent (specific formulation proprietary, typically a sterile aqueous buffer). For research purposes, information on compatible solvents is not publicly detailed. |
| Storage (Lyophilized) | Unopened vials should be stored refrigerated at 2°C to 8°C (36°F to 46°F) in the original carton to protect from light. Do not freeze. |
| Storage (Reconstituted) | Refrigerate at 2°C to 8°C (36°F to 46°F). Use within a specified period (e.g., 30 days) as per the clinical trial protocol; discard if frozen or if particulate matter or discoloration is observed. |
| Typical Research Dose | In clinical research, doses are in the milligram range (e.g., 1 mg to 12 mg weekly). A 'typical' research dose is not established as it is under investigation; studies use specific escalating regimens. |
| Cycle Parameters | In clinical trials, administration is once weekly via subcutaneous injection, often with a dose-escalation phase over several weeks. Treatment cycles in studies are continuous, with durations extending to 48 weeks or longer in ongoing Phase 3 trials. |
| Amino Acid Count | 5 |
Mechanism of Action
Retatrutide functions as a unimolecular triple agonist at the GIP, GLP-1, and glucagon receptors. Each receptor activation contributes distinct but synergistic metabolic effects. The peptide is engineered to have balanced affinity and efficacy at all three receptors, leading to integrated signaling pathways that influence appetite, energy expenditure, glucose homeostasis, and lipid metabolism.
GIP Receptor Agonism: Activation enhances postprandial insulin secretion in a glucose-dependent manner, promotes nutrient deposition in adipose tissue under healthy conditions, and may contribute to weight loss effects in the context of obesity by improving adipose tissue function and potentially increasing energy expenditure.
GLP-1 Receptor Agonism: Activation suppresses appetite and food intake via central actions in the hypothalamus and hindbrain, delays gastric emptying, and stimulates glucose-dependent insulin secretion from pancreatic beta cells while suppressing glucagon secretion from alpha cells.
Glucagon Receptor Agonism: Activation increases energy expenditure by stimulating hepatic glycogenolysis and gluconeogenesis, but its primary therapeutic effect in this context is believed to be the promotion of lipolysis and fatty acid oxidation, thereby reducing hepatic steatosis and potentially amplifying overall calorie expenditure. The glucagon activity is carefully balanced to avoid excessive hyperglycemia.
Research Applications
Obesity and Weight Management: In Phase 2 clinical trials, Retatrutide has demonstrated profound weight reduction in participants with obesity. The triple-hormone mechanism appears to produce greater weight loss than GLP-1 receptor agonists alone, likely due to combined effects on satiety (GLP-1), adipose tissue metabolism (GIP), and energy expenditure (glucagon).
Type 2 Diabetes Mellitus: Research indicates it significantly improves glycemic control by enhancing insulin secretion (via GIP and GLP-1), suppressing inappropriate glucagon secretion (via GLP-1), and improving insulin sensitivity. The glucagon component's effect on hepatic glucose production is modulated by the concurrent insulinotropic actions.
Non-alcoholic Fatty Liver Disease (NAFLD)/NASH: Preclinical and early clinical data suggest potential benefits for hepatic fat reduction. Glucagon receptor agonism promotes hepatic fatty acid oxidation and inhibits de novo lipogenesis, while GLP-1 and GIP actions improve systemic metabolic parameters that drive NAFLD.
Cardiometabolic Risk Factors: Studies report improvements in cardiometabolic biomarkers, including reductions in triglycerides, blood pressure, and inflammatory markers, which are areas of active investigation for long-term cardiovascular outcomes.
Safety & Side Effects
The safety profile from clinical trials is consistent with the mechanism of action and similar to other incretin-based therapies. The most common adverse events are gastrointestinal, including nausea, vomiting, diarrhea, and constipation, which are generally mild to moderate in severity and transient, often occurring during dose escalation. Other reported side effects include injection site reactions, increased heart rate, and transient increases in blood glucose during initial dosing (related to glucagon receptor activity). Theoretical concerns include the risk of pancreatitis, gallbladder disease, and medullary thyroid carcinoma (based on rodent toxicology studies with other GLP-1 receptor agonists), although no direct causal link to Retatrutide has been established in humans. Hypoglycemia risk is low when used without insulin or sulfonylureas due to the glucose-dependent nature of its insulinotropic effects.
Dosage Information
This information is derived from published clinical research protocols only and is not intended as guidance for use.
In clinical trials for obesity, Retatrutide has been administered via subcutaneous injection. The dose is typically escalated over several weeks to improve gastrointestinal tolerability. In the Phase 2 trial, doses ranged from 1 mg to 12 mg, administered once weekly. The treatment duration in completed studies has been up to 48 weeks. The optimal dose and escalation schedule remain under investigation in ongoing Phase 3 trials.
References
Jastreboff, A.M., et al. Triple–Hormone-Receptor Agonist Retatrutide for Obesity — A Phase 2 Trial. New England Journal of Medicine, 2023, 389(6), 514-526.
Coskun, T., et al. LY3437943, a novel triple GIP, GLP-1, and glucagon receptor agonist in people with type 2 diabetes: a phase 1b, multicentre, double-blind, placebo-controlled, randomised, multiple-ascending dose trial. The Lancet, 2022, 400(10366), 1869-1881.
Urva, S., et al. The novel dual glucose-dependent insulinotropic polypeptide and glucagon-like peptide-1 agonist, tirzepatide, transiently delays gastric emptying similarly to selective glucagon-like peptide-1 agonists. Diabetes, Obesity and Metabolism, 2020, 22(10), 1886-1891. (Context for dual/triple agonist class)
Finan, B., et al. A rationally designed monomeric peptide triagonist corrects obesity and diabetes in rodents. Nature Medicine, 2015, 21(1), 27-36. (Seminal preclinical work on triple agonism)
Tillner, J., et al. A novel dual glucagon-like peptide and glucagon receptor agonist SAR425899: Results of randomized, placebo-controlled first-in-human and first-in-patient trials. Diabetes, Obesity and Metabolism, 2019, 21(1), 120-128. (Context for glucagon/GLP-1 co-agonism)
Müller, T.D., et al. The New Biology and Pharmacology of Glucagon. Physiological Reviews, 2017, 97(2), 721-766.
Eli Lilly and Company. A Study of Retatrutide (LY3437943) in Participants With Obesity (TRIUMPH-1). ClinicalTrials.gov Identifier: NCT05931380.