Mechanism
Pramlintide is a 37-amino-acid synthetic analog of native amylin with three substitutions (proline at positions 25, 28, 29) that prevent the amyloid aggregation that limits native amylin’s therapeutic use. Native amylin is co-secreted with insulin from pancreatic beta cells — patients with type 1 diabetes (autoimmune beta-cell destruction) and many with advanced type 2 diabetes are amylin-deficient as well as insulin-deficient.
Three primary mechanisms (parallel to GLP-1 but distinct receptor):
- Slowed gastric emptying — reduces postprandial glucose excursion by spreading nutrient absorption over a longer window
- Suppressed inappropriate post-meal glucagon — reduces hepatic glucose output during meals
- Central appetite suppression — modest reduction in food intake, modest weight loss
The amylin receptor is a calcitonin receptor / RAMP heterodimer — distinct from GLP-1 receptors. This is why amylin agonism and GLP-1 agonism produce additive effects when combined (the rationale behind CagriSema).
Half-life is ~48 minutes subcutaneously — short enough that pre-meal dosing is required for each meal.
What the evidence shows
T1D (Whitehouse et al, Diabetes Care 2002, and follow-on studies): Multi-trial program showing pramlintide + mealtime insulin improves HbA1c, reduces postprandial glucose excursions, and produces modest weight loss compared to insulin alone. Effect on HbA1c is modest (~0.3–0.5%) but accompanied by ~1–2 kg weight loss versus insulin’s typical weight gain.
T2D (Hollander et al, Diabetes Care 2003): In insulin-treated T2D, pramlintide adjunctive therapy produced similar HbA1c improvements with weight loss versus weight neutrality on insulin alone.
Real-world adoption: Has been disappointing relative to the trial data. Practical barriers — separate injection, complex titration, hypoglycemia risk — are significant. The drug retains a small niche in T1D patients who can’t achieve postprandial control on intensive insulin alone.
Off-label use: Some interest in obesity (without diabetes) and gastroparesis; not approved and the evidence base is thin.
Dosing literature
Approved dosing (subcutaneous, before meals):
- Type 1 diabetes: Start 15 mcg before each meal; titrate by 15 mcg every 3 days based on tolerance up to 30–60 mcg per meal
- Type 2 diabetes (insulin-treated): Start 60 mcg before each meal; titrate to 120 mcg
Critical: Mealtime rapid-acting insulin dose must be reduced ~50% at pramlintide initiation to prevent severe hypoglycemia. Insulin doses are then titrated upward as tolerance and glucose patterns dictate.
The two-injection mealtime burden (pramlintide + insulin) is the practical adoption barrier. Combination products have been explored but not commercialized.
Risks and adverse events
Most clinically relevant:
- Severe hypoglycemia — boxed warning. Risk highest in initial weeks before insulin doses are reduced/adjusted. Patient education is critical.
- Nausea — very common (~30%), often severe enough to limit titration. Frequently improves over weeks but can be persistent.
- Vomiting, decreased appetite — class-typical for satiety-affecting drugs
Less common:
- Headache, fatigue
- Injection site reactions
- Anorexia
Practical considerations:
- Cannot be mixed in same syringe with insulin (different pH)
- Refrigerated storage of opened pen for 30 days; specific stability rules
- Pre-meal timing requires planning around erratic meal schedules
These practical barriers explain why a clinically effective drug has limited real-world uptake.
Regulatory status
| Region | Status | Notes |
|---|---|---|
| United States | Approved (Symlin, Symlinpen) — commercially discontinued October 27, 2025 | FDA approval remains on file; AstraZeneca discontinued manufacture for commercial reasons (not safety or efficacy). No commercial product currently available. |
| European Union | Not approved | Withdrawn from EU regulatory review |
| United Kingdom | Not approved | |
| Australia | Not approved | |
| Most non-US markets | Not approved |
The non-US regulatory absence was unusual for a drug with US FDA approval — reflected sponsor commercial decisions rather than efficacy concerns. Manufacturer: AstraZeneca (acquired from Amylin). The October 2025 US discontinuation closed the only major market where the drug was available.
Where to get it
Pramlintide (Symlin) is no longer commercially available in the US as of October 27, 2025. Patients who were stable on Symlin should consult their endocrinologist about alternative postprandial glucose-control strategies — typically tighter
Quick Facts
| Also Known As | AC137, Symlin |
|---|---|
| Sequence | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY |
| Molecular Formula | C171H267N51O53S2 |
| Molecular Weight | 3949 Da |
| PubChem CID | 70691388 |
Research Parameters
| Half-Life | ~48 minutes |
|---|---|
| Stability | Lyophilized powder is stable when stored as recommended. After reconstitution with sterile diluent, solutions should be stored refrigerated and are typically stable for up to 30 days. |
| Solubility | Sterile Water or Bacteriostatic Water for injection |
| Storage (Lyophilized) | Store lyophilized powder at -20°C, protected from light and moisture. |
| Storage (Reconstituted) | Store reconstituted solution at 2-8°C (refrigerated). Do not freeze. |
| Typical Research Dose | In clinical research: 30-120 mcg per subcutaneous injection |
| Cycle Parameters | In clinical research protocols: Daily subcutaneous injections, typically 3 times daily prior to main meals, for study durations ranging from weeks to months. |
| Amino Acid Count | 37 |
Mechanism of Action
Pramlintide acts as an amylin receptor agonist, primarily targeting receptors in the central nervous system and other tissues. Its mechanism complements insulin by addressing physiological pathways that insulin does not directly modulate.
Slowing Gastric Emptying: Pramlintide reduces the rate at which food empties from the stomach into the small intestine. This delays the absorption of nutrients, particularly carbohydrates, leading to a more gradual rise in postprandial blood glucose levels.
Suppressing Glucagon Secretation: During meals, pramlintide suppresses the secretion of glucagon from pancreatic alpha cells. Glucagon normally stimulates hepatic glucose output; its suppression reduces the glucose contribution from the liver during the postprandial period.
Promoting Satiety: Pramlintide acts centrally in the brain, particularly in areas like the hypothalamus, to induce a feeling of fullness or satiety. This can lead to reduced food intake, contributing to weight management, which is often a concern in diabetes therapy.
Research Applications
Diabetes Management: Pramlintide has been extensively researched as an adjunct therapy for both type 1 and type 2 diabetes. Studies show it improves postprandial glycemic control, reduces glycemic variability, and can lead to modest reductions in body weight when used alongside insulin. It addresses the 'amylin deficit' present in diabetes, where amylin secretion is impaired alongside insulin.
Weight Management: Independent of its glucose effects, research has investigated pramlintide for weight loss. Its satiety-promoting effects can reduce caloric intake. Studies have explored its potential, sometimes in combination with other hormones like leptin, for obesity treatment.
Beta Cell Function Preservation: In preclinical research, amylin and its analogs have been studied for potential protective effects on pancreatic beta cells, though this is less established in human clinical research compared to its acute metabolic effects.
Safety & Side Effects
The primary safety concern from clinical studies is the risk of hypoglycemia, especially when initiated without careful insulin dose adjustment. Nausea is the most common anecdotally reported side effect, particularly at the initiation of therapy, and tends to diminish over time. Other reported effects include vomiting, anorexia, and headache. Theoretical concerns include potential interactions with other drugs affecting gastric motility or glucose metabolism. In animal studies, no major organ toxicity was reported at therapeutic doses, but high doses could potentiate insulin-induced hypoglycemia.
Dosage Information
Note: The following information is derived from published clinical research studies and is for research reference only. Pramlintide (Symlin) is an FDA-approved drug with specific prescribing guidelines; research use should adhere to ethical and regulatory standards.
In clinical trials, pramlintide is administered via subcutaneous injection. For type 1 diabetes, research doses typically ranged from 30 to 60 mcg per injection, administered prior to major meals. For type 2 diabetes, research doses were often higher, ranging from 60 to 120 mcg per injection pre-meals. The frequency is tied to meal intake, typically three times daily with main meals. Duration in studies has varied from short-term acute studies to long-term trials lasting 6 months to 2 years to assess chronic efficacy and safety.
References
Edelman, S., Garg, S., Frias, J., et al. A double-blind, placebo-controlled trial assessing pramlintide treatment in the setting of intensive insulin therapy in type 1 diabetes. Diabetes Care. 2006.
Ratner, R., Whitehouse, F., Fineman, M., et al. Adjunctive therapy with pramlintide in patients with type 2 diabetes using insulin: A randomized controlled trial. Diabetes Obesity and Metabolism. 2005.
Young, A. Amylin and the integrated control of nutrient influx. Advances in Pharmacology. 2005.
Kong, M., King, A., & St-Pierre, D. Differential effects of amylin on hepatic and peripheral glucose disposal in dogs. Endocrinology., 1998.
Thompson, R., Pearson, L., & Schoenfeld, S. Pramlintide, an amylin analog, delayed gastric emptying in rats. Regulatory Peptides. 1997.
Weyer, C., Maggs, D., & Kolterman, O. Amylin replacement with pramlintide in type 1 diabetes: A physiological approach to overcome beta-cell deficiency. Diabetes Technology & Therapeutics. 2002.