Enfuvirtide is a 36-amino acid synthetic peptide and the first member of the class of HIV entry inhibitors, specifically a fusion inhibitor. It was developed based on the discovery of peptides derived from the C-terminal heptad repeat (HR2) region of the HIV-1 transmembrane glycoprotein gp41 that potently inhibit viral entry. Its discovery stemmed from research into the mechanism of HIV fusion with the host cell membrane, which involves a conformational change in gp41 where HR1 and HR2 domains interact to form a six-helix bundle, bringing the viral and cellular membranes together. Enfuvirtide is significant as it represents a novel therapeutic strategy targeting an extracellular step of the HIV lifecycle, providing an option for patients with multi-drug resistant virus. It was approved by the FDA in 2003, marking a milestone in antiretroviral therapy.
Quick Facts
| Also Known As | T-20, DP-178, Pentafuside, Fuzeon |
|---|---|
| Sequence | YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF |
| Molecular Formula | C204H301N51O64 |
| Molecular Weight | 4492 Da |
| PubChem CID | 16130199 |
Research Parameters
| Half-Life | ~3.8 hours (following subcutaneous administration in humans) |
|---|---|
| Stability | Lyophilized powder is stable when stored as directed. After reconstitution with Sterile Water for Injection, the solution should be used immediately. If necessary, reconstituted solution can be refrigerated at 2-8°C for up to 24 hours. It should not be frozen or shaken. |
| Solubility | Sterile Water for Injection (not Bacteriostatic Water) |
| Vial Size | 108 mg |
| Storage (Lyophilized) | Store at 2-8°C (36-46°F). Protect from light. |
| Storage (Reconstituted) | Refrigerate at 2-8°C (36-46°F) and use within 24 hours. Do not freeze or shake. Discard any unused solution. |
| Typical Research Dose | 90,000 mcg (90 mg) per injection |
| Cycle Parameters | In clinical research, administered as a continuous, long-term therapy via twice-daily (every 12 hours) subcutaneous injections, as part of a combination antiretroviral regimen. No defined 'cycle' with on/off periods. |
| Amino Acid Count | 36 |
Mechanism of Action
Enfuvirtide acts as a competitive inhibitor of the HIV-1 fusion process by binding to the viral gp41 glycoprotein. The fusion of HIV-1 with the host cell membrane is mediated by the envelope glycoproteins gp120 and gp41. After gp120 binds to CD4 and a coreceptor (CCR5 or CXCR4) on the target cell, gp41 undergoes a conformational change, exposing its fusion peptide and allowing the HR1 and HR2 domains to interact, forming a stable six-helix bundle that drives membrane fusion.
Primary Mechanism: Enfuvirtide, which mimics the HR2 domain, binds with high affinity to the HR1 domain of gp41 during the fusion intermediate state. This binding prevents the natural interaction between the viral HR1 and HR2 domains, thereby inhibiting the formation of the six-helix bundle fusion complex. This blockade stops the apposition and subsequent fusion of the viral and cellular membranes, preventing viral entry and infection of the host cell.
Specificity: The peptide is specific for HIV-1 and does not inhibit HIV-2 or other enveloped viruses due to sequence differences in the gp41 HR1 region. Resistance to enfuvirtide is associated with mutations in the HR1 domain of gp41 that reduce the binding affinity of the peptide.
Research Applications
HIV Therapy and Resistance: Enfuvirtide has been extensively researched as a salvage therapy for treatment-experienced patients with multi-drug resistant HIV-1. Studies demonstrate its efficacy in reducing viral load and increasing CD4+ T-cell counts when added to an optimized background regimen. Research continues to explore its role in specific populations and its utility in managing virological failure.
Viral Entry and Fusion Mechanisms: As a prototypical fusion inhibitor, enfuvirtide is a critical tool in basic virology research. It is used to study the detailed biophysical and structural dynamics of the HIV envelope glycoprotein conformational changes, membrane fusion processes, and the development of viral resistance to entry inhibitors.
Peptide Therapeutics Development: The development and clinical success of enfuvirtide have served as a proof-of-concept for peptide-based antiviral drugs. Research investigates the lessons learned from its pharmacokinetics, formulation (requiring twice-daily subcutaneous injection), and resistance profile to inform the design of next-generation, longer-acting fusion inhibitors and other therapeutic peptides.
Safety & Side Effects
The primary safety concern from clinical use is injection site reactions (ISRs), reported in nearly all patients. These include pain, induration, erythema, nodules, cysts, pruritis, and ecchymosis. Systemic side effects may include insomnia, peripheral neuropathy, anxiety, depression, and increased incidence of bacterial pneumonia. Hypersensitivity reactions have been reported. Eosinophilia and other immune-mediated effects are possible. In preclinical animal studies (e.g., monkeys, rats), local tolerability at the injection site was a key finding. Theoretical concerns include immunogenicity due to its peptide nature, though significant neutralizing antibody formation was not commonly reported.
Dosage Information
This information is derived from historical clinical research and is presented for educational purposes only. In clinical studies, enfuvirtide was administered via subcutaneous injection. The standard adult dose was 90 mg (approximately 1.0 mg/kg) injected twice daily (BID) into the upper arm, thigh, or abdomen. The injection site was rotated. Treatment duration in studies varied but often continued as long-term therapy as part of a combination antiretroviral regimen. Research into alternative dosing regimens (e.g., once-daily) or delivery methods has been limited.
References
Kilby, J.M., Hopkins, S., Venetta, T.M., et al. Potent suppression of HIV-1 replication in humans by T-20, a peptide inhibitor of gp41-mediated virus entry. Nature Medicine, 1998. 4(11), 1302-1307.
Lalezari, J.P., Henry, K., O'Hearn, M., et al. Enfuvirtide, an HIV-1 fusion inhibitor, for drug-resistant HIV infection in North and South America. New England Journal of Medicine, 2003. 348(22), 2175-2185.
Wild, C., Greenwell, T., Matthews, T. A synthetic peptide from HIV-1 gp41 is a potent inhibitor of virus-mediated cell-cell fusion. AIDS Research and Human Retroviruses, 1993. 9(11), 1051-1053.
Matthews, T., Salgo, M., Greenberg, M., et al. Enfuvirtide: the first therapy to inhibit the entry of HIV-1 into host CD4 lymphocytes. Nature Reviews Drug Discovery, 2004. 3(3), 215-225.
Baldwin, C.E., Sanders, R.W., Berkhout, B. Inhibiting HIV-1 entry with fusion inhibitors. Current Medicinal Chemistry, 2003. 10(17), 1633-1642.
Poveda, E., Briz, V., Soriano, V. Enfuvirtide, the first fusion inhibitor to treat HIV infection. AIDS Reviews, 2005. 7(3), 139-147.