Cathelicidin LL-37 is a 37-amino acid, amphipathic, alpha-helical peptide and the sole cathelicidin-family antimicrobial peptide (AMP) identified in humans. It is proteolytically cleaved from its precursor protein, hCAP-18, stored in neutrophil granules and various epithelial cells, and released at sites of infection or injury. Discovered in the late 1990s, LL-37 is a critical component of the innate immune system, providing a first line of defense against a broad spectrum of pathogens, including bacteria, viruses, and fungi. Its significance extends beyond direct microbial killing, as it is a key immunomodulatory molecule that influences chemotaxis, cytokine release, angiogenesis, and wound healing, bridging innate and adaptive immunity. Dysregulation of LL-37 expression is implicated in various diseases, from chronic infections and poor wound healing to autoimmune conditions like psoriasis.
Quick Facts
| Also Known As | LL-37, hCAP-18/LL-37, CAMP-derived peptide, FALL-39 (human), CRAMP (murine homolog) |
|---|---|
| Sequence | [LL-37, 37 aa] |
| Molecular Formula | C205H340N60O53 |
| Molecular Weight | 4493 Da |
| PubChem CID | 16198951 |
Research Parameters
| Half-Life | Unknown in systemic circulation. Likely short (minutes) due to rapid proteolytic degradation and tissue binding. Topical/local application aims for sustained presence. |
|---|---|
| Stability | Lyophilized powder is stable for at least 24 months when stored at -20°C or below, protected from light and moisture. After reconstitution in sterile water or buffer, solutions are typically stable for 7-28 days when stored at 2-8°C, depending on concentration and buffer conditions. Repeated freeze-thaw cycles of reconstituted solutions are not recommended. |
| Solubility | Reconstitutes readily in sterile water, bacteriostatic water (with 0.9% benzyl alcohol), or phosphate-buffered saline (PBS). A mild acidic solution (e.g., 0.1% acetic acid) can be used to enhance solubility for higher concentrations. |
| Vial Size | 1 mg |
| Storage (Lyophilized) | -20°C or below, desiccated, protected from light. For long-term storage, -80°C is recommended. |
| Storage (Reconstituted) | 2-8°C (refrigerated) for short-term use (typically up to 28 days). For longer storage, aliquot and freeze at -20°C or below, avoiding repeated freeze-thaw cycles. |
| Typical Research Dose | In vitro research: 1-50 µg/mL. In vivo animal research: 100-5000 mcg/kg. |
| Cycle Parameters | Research protocols vary extensively. For wound healing models in mice: Daily topical application or subcutaneous injection near the wound site for 7-14 days. For infection models: Often a single or few administrations coinciding with or following pathogen challenge. |
| Amino Acid Count | 37 |
Mechanism of Action
LL-37 exhibits a multifaceted mechanism of action that integrates direct antimicrobial activity with complex immunomodulation. Its primary mechanism involves disrupting microbial membranes via electrostatic interactions and pore formation, but it also acts through specific host receptors to modulate immune responses.
Membrane Disruption: The peptide's cationic and amphipathic structure allows it to interact electrostatically with negatively charged microbial membranes (e.g., bacterial lipopolysaccharides). It then inserts into the lipid bilayer, often adopting a transmembrane orientation that leads to pore formation, membrane depolarization, and eventual microbial cell lysis.
Receptor-Mediated Signaling: LL-37 binds to several host cell receptors, most notably the formyl peptide receptor 2 (FPR2/ALX) and possibly the P2X7 purinergic receptor. Binding to FPR2 on immune cells like neutrophils, monocytes, and T-cells triggers intracellular signaling cascades (e.g., MAPK, PI3K/Akt), leading to chemotaxis, phagocytosis, and the release of cytokines and chemokines.
Intracellular Effects: Beyond membrane lysis, LL-37 can translocate into bacterial cells and bind to intracellular targets, inhibiting vital processes like DNA and protein synthesis. In host cells, it can neutralize endotoxins like LPS, preventing TLR4 activation and subsequent pro-inflammatory cytokine storms.
Immunomodulation: LL-37 modulates the inflammatory response by promoting the recruitment of immune cells to sites of infection, enhancing phagocytosis, and influencing the differentiation of T-cells and dendritic cells. It can also induce the release of interleukin-8 (IL-8) and other chemokines, amplifying the immune response. In wound healing, it promotes angiogenesis, re-epithelialization, and the production of extracellular matrix components.
Research Applications
Antimicrobial Research: LL-37 is a model peptide for studying host defense peptides and developing novel antibiotics, especially against multidrug-resistant bacteria. Its broad-spectrum activity and lower propensity for inducing resistance compared to conventional antibiotics make it a promising therapeutic candidate.
Dermatology and Wound Healing: Research demonstrates LL-37's potent role in promoting keratinocyte migration, proliferation, and differentiation. It stimulates angiogenesis and re-epithelialization in chronic wounds (e.g., diabetic ulcers, venous leg ulcers) and modulates inflammation in skin conditions, with notable implications for psoriasis where it is overexpressed and forms complexes with self-DNA to drive inflammation.
Immunology and Autoimmunity: Studies focus on its dual role as both a pro-inflammatory and anti-inflammatory agent. In autoimmune diseases like psoriasis and lupus, LL-37 can trigger inflammatory cascades. Conversely, in settings of immune suppression or chronic infection, boosting LL-37 activity is investigated as a way to enhance clearance of pathogens and resolve inflammation.
Oncology: Preliminary research explores LL-37's effects on cancer cells. It can exhibit cytotoxic activity against certain cancer cell lines in vitro and may influence tumor microenvironment and angiogenesis, though its effects are highly context- and cancer-type-dependent.
Viral Infections: LL-37 has demonstrated antiviral activity against viruses such as influenza, HIV, and herpes simplex virus (HSV) by disrupting viral envelopes or inhibiting viral entry into host cells, making it a subject of research for novel antiviral strategies.
Safety & Side Effects
From animal studies, LL-37 is generally well-tolerated at physiological and moderately supraphysiological doses. However, its cationic nature and membrane-active properties pose theoretical risks of cytotoxicity to host cells at high concentrations, potentially leading to hemolysis or epithelial damage. In the context of autoimmune diseases like psoriasis, elevated LL-37 levels are pathogenic, triggering inflammatory responses through complex formation with self-nucleic acids. Anecdotal reports from research contexts are minimal, but theoretical concerns include local irritation at injection/application sites and the potential to exacerbate autoimmune conditions if systemically administered. Its role in sepsis is complex, as it can both neutralize endotoxins and potentially contribute to excessive inflammation.
Dosage Information
This information is derived from preclinical and limited clinical research studies only. It is not intended for human therapeutic use.
In research settings, administration varies widely by model. In vitro studies use concentrations typically ranging from 1 to 50 µg/mL. In animal models (e.g., murine wound healing or infection studies), doses range from 0.1 to 5 mg/kg, administered via topical application to wounds, intranasal instillation for respiratory infections, or subcutaneous/intraperitoneal injection. Frequency is often daily or every other day, with treatment durations lasting from a few days to several weeks, depending on the experimental endpoint. Human clinical trials for topical wound healing have used formulated gels containing LL-37 at concentrations such as 0.5-3.0 mg/mL applied daily.
References
1. Zanetti, M. Cathelicidins, multifunctional peptides of the innate immunity. Journal of Leukocyte Biology, 2004.
2. Durr, U.H.N., et al. LL-37, the only human member of the cathelicidin family, induces protease-dependent cancer cell death. Biochimica et Biophysica Acta (BBA) - Molecular Cell Research, 2006.
3. Koczulla, A.R., et al. An angiogenic role for the human peptide antibiotic LL-37/hCAP-18. Journal of Clinical Investigation, 2003.
4. Nizet, V., et al. Innate antimicrobial peptide protects the skin from invasive bacterial infection. Nature, 2001.
5. Lande, R., et al. Plasmacytoid dendritic cells sense self-DNA coupled with antimicrobial peptide. Nature, 2007.
6. Larrick, J.W., et al. Human CAP18: a novel antimicrobial lipopolysaccharide-binding protein. Infection and Immunity, 1995.
7. Turner, J., et al. Activities of LL-37, a cathelin-associated antimicrobial peptide of human neutrophils. Antimicrobial Agents and Chemotherapy, 1998.
8. Hancock, R.E.W., & Sahl, H.G. Antimicrobial and host-defense peptides as new anti-infective therapeutic strategies. Nature Biotechnology, 2006.